PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240587.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 273aa    MW: 29507.9 Da    PI: 6.2433
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240587.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.41.6e-152383257
                    T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    r+R+ +++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  XP_008240587.2 23 RSRWIPKPEQILILESIFNSgMVNPPKEETVRIRKLLekfgTIGDANVFYWFQNRRSRSRR 83
                    89*****************99*************************************997 PP

2Wus_type_Homeobox105.24.3e-342285265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RW P+peQi iLe++++sG+++P+kee+ ri++ Le++G i+d+NVfyWFQNr++R+r++q
     XP_008240587.2 22 VRSRWIPKPEQILILESIFNSGMVNPPKEETVRIRKLLEKFGTIGDANVFYWFQNRRSRSRRRQ 85
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.3371984IPR001356Homeobox domain
SuperFamilySSF466898.13E-141990IPR009057Homeodomain-like
SMARTSM003894.4E-62188IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.8E-82288IPR009057Homeodomain-like
PfamPF000462.7E-132383IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEDKGQDPNS PGNGSERSSE PVRSRWIPKP EQILILESIF NSGMVNPPKE ETVRIRKLLE  60
KFGTIGDANV FYWFQNRRSR SRRRQRQLQA SLEQRNNTNS NQVGDHQMGI SSGAIQYEIS  120
CSPSAPAPAI AFGASPTSFG SCNYLVGSSS SPSSGHHLMA DHDQQTSSSV DQFFSVSGQM  180
GFPEIEQGSG VTSVLGGAPS DTSTLPFQSG LITVFINGVP AEVPKGPLDM KSMFGQDVLL  240
VHSSGLPLPL NEFGFLAHGL QPGESYFLVS RTT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240587.10.0PREDICTED: LOW QUALITY PROTEIN: WUSCHEL-related homeobox 11
SwissprotQ6X7J32e-73WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLM5VTQ21e-172M5VTQ2_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s06310.11e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58983152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.15e-69WUSCHEL related homeobox 11